PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 311aa    MW: 34569.9 Da    PI: 6.5909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027456genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.89.4e-121591148
                     TSSS-HHHHHHHHHHHHHTTTT.............................-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.............................tWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEd++l  ++ + G g                             +W+t++   g+ R +k+c++rw +yl
      Lus10027456 15 RGLWSPEEDDRLRSYIVRNGHGclatapikggkiilvppfifishirnghgCWTTVPINAGLQRNGKSCRLRWINYL 91
                     788************************************************************************97 PP

2Myb_DNA-binding45.51.7e-1497142148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++ E++ ++ ++++lG++ W+ Ia+++  gRt++++k++w++yl
      Lus10027456  97 RGLFSAHEEDTILTLHRLLGNK-WSQIASHLS-GRTDNEIKNYWHSYL 142
                      7889******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-16994IPR009057Homeodomain-like
PROSITE profilePS500909.0821091IPR017877Myb-like domain
SMARTSM007171.5E-61493IPR001005SANT/Myb domain
SuperFamilySSF466894.3E-51593IPR009057Homeodomain-like
SuperFamilySSF466891.16E-2077148IPR009057Homeodomain-like
PROSITE profilePS5129424.09692146IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-2495146IPR009057Homeodomain-like
SMARTSM007174.1E-1496144IPR001005SANT/Myb domain
PfamPF002491.1E-1297142IPR001005SANT/Myb domain
CDDcd001673.92E-10100142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MKGCKDQKAK PKLRRGLWSP EEDDRLRSYI VRNGHGCLAT APIKGGKIIL VPPFIFISHI  60
RNGHGCWTTV PINAGLQRNG KSCRLRWINY LRPGLKRGLF SAHEEDTILT LHRLLGNKWS  120
QIASHLSGRT DNEIKNYWHS YLKRKILKPQ QCASSSSLVE SSSALSCDRP EESLPSISNV  180
FAYQSYNNNF TIGLDNASSR PLLPPNLMFS EWLSMDCSES TTSAAEVLFP KEGFACGSDE  240
FSIDIVPSSE FVGEHLFQGY DRNSTTMSDG SASDMLSSQL DFGDQGLDDA DQFVGFCTDF  300
HLDVDSVVYI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-17111463108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744470.0JX174447.1 Linum usitatissimum clone LuBAC375N24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9M0K41e-53LAF1_ARATH; Transcription factor LAF1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.13e-55myb domain protein 45